PAN Pesticides Database - Chemicals |
|
Home > Chemical Search |
Alkyl-1,3-propylene diamine acetate, alkyl derived from coconut oil fatty acids - Identification, toxicity, use, water pollution potential, ecological toxicity and regulatory information |
Note: See Working with the Information on this Page section below for important notes about this data. |
|
This website and underlying databases are maintained and updated by Pesticide Action Network North America (PAN). The project is made possible by our Sponsors and by PAN general funds. We need your support to maintain and improve this system. Please support the database and website — donate to PANNA. |
|
Identifying information, including synonyms, ID numbers, use type, chemical classification, a link to a list of all products containing this chemical and a list of the top crops this pesticide is used on in California. | |
Signs and symptoms of poisoning, first aid, and links to treatment information for this chemical. | |
Link to information on toxicity to humans, including carcinogenicity, reproductive and developmental toxicity, neurotoxicity, and acute toxicity. | |
Links to world-wide registration status as well as regulatory information for the U.S. and California. | |
Water quality standards and physical properties affecting water contamination potential. | |
Toxicity to aquatic organisms. | |
List of chemicals in the same family, including breakdown products, salts, esters, isomers, and other derivatives. | |
Chemical Identification and Use for Alkyl-1,3-propylene diamine acetate, alkyl derived from coconut oil fatty acids |
Basic Identification Information About This Chemical |
|
Chemical Name: | Alkyl-1,3-propylene diamine acetate, alkyl derived from coconut oil fatty acids |
CAS Number: | 61790-63-7 |
U.S. EPA PC Code: | |
CA DPR Chem Code: | 1380 |
Molecular Weight: | 0 |
Use Type: |
![]() ![]() |
Chem Class: |
![]() |
![]() |
|
Additional Resources About This Chemical Class and Use Type | |
Other Names for this Chemical | |
01380 (CA DPR Chem Code Text ) , 1380 (CA DPR Chem Code) ) , 61790-63-7 (CAS number) , 61790637 (CAS number without hyphens) , Alkyl-1,3-propylene diamine acetate, alkyl derived from coconut oil fatty acids , ALKYL-1,3-PROPYLENE DIAMINE ACETATES , ALKYL-1,3-PROPYLENEDIAMINE ACETATE ALKYL DERIVED FROM COCONUT OIL FATTY ACIDS , Alkyl13propylenediamineacetatealkylderivedfromcoconutoilfattyacids | |
Products Containing This ChemicalCurrent and historic U.S. registered products | |
Signs and Symptoms of Alkyl-1,3-propylene diamine acetate, alkyl derived from coconut oil fatty acids Poisoning |
![]() |
NOTE! There may be other diseases and chemicals that have similar symptoms. |
![]() |
If you have a poisoning emergency in the United States call 1-800-222-1222. |
Sorry! No symptoms for this chemical or chemical group are available. See related chemicals for possible additional information. |
||||
Toxicity Information for Alkyl-1,3-propylene diamine acetate, alkyl derived from coconut oil fatty acids |
|
Summary Toxicity Information | ||||||
PAN Bad Actor Chemical 1 | Acute Toxicity 2 | Carcinogen | Cholinesterase Inhibitor | Ground Water Contaminant | Developmental or Reproductive Toxin | Endocrine Disruptor |
---|---|---|---|---|---|---|
Not Listed | ![]() |
![]() |
No | ![]() |
![]() |
![]() |
![]() |
Indicates high toxicity in the given toxicological category. | ![]() |
Indicates no available weight-of-the-evidence summary assessment. For additional information on toxicity from scientific journals or registration documents, see the "Additional Resources for Toxicity " section of the chemical detail page. |
1. PAN Bad Actors are chemicals that are one or more of the following: highly acutely toxic, cholinesterase inhibitor, known/probable carcinogen, known groundwater pollutant or known reproductive or developmental toxicant. NOTE! Because there are no authoritative lists of Endocrine Disrupting (ED) chemicals, EDs are not yet considered PAN Bad Actor chemicals. | |||
2. The acute toxicity reported on this page is of the pure chemical ingredient only and may not reflect the acute toxicity of individual pesticide products. To view acute toxicity of individual products, click on 'View Products' link in the 'Chemical Identification' section above. | |||
Detailed Toxicity Information |
|
|
Acute Toxicity 2 |
Alkyl-1,3-propylene diamine acetate, alkyl derived from coconut oil fatty acids | |
WHO Acute Hazard TRI Acute Hazard Material Safety Data Sheets Acute rating from U.S. EPA product label U.S. NTP Acute Toxicity Studies ![]() Cholinesterase Inhibitor |
Not Listed Not Listed Not Available No Consensus Value No NTP Studies No |
|
2. The acute toxicity reported on this page is of the pure chemical ingredient only and may not reflect the acute toxicity of individual pesticide products. To view acute toxicity of individual products, click on 'View Products' link in the 'Chemical Identification' section above. | ||
Cancer Information |
Alkyl-1,3-propylene diamine acetate, alkyl derived from coconut oil fatty acids | |
IARC Carcinogens U.S. NTP Carcinogens California Prop 65 Known Carcinogens U.S. EPA Carcinogens TRI Carcinogen |
Not Listed Not Listed Not Listed Not Listed Not Listed |
|
Endocrine Disruption |
Alkyl-1,3-propylene diamine acetate, alkyl derived from coconut oil fatty acids | |
Illinois EPA list Keith list Colborn list Benbrook list Danish Inert list EU list |
Not Listed Not Listed Not Listed Not Listed Not Listed Not Listed |
|
Reproductive and Developmental Toxicity |
Alkyl-1,3-propylene diamine acetate, alkyl derived from coconut oil fatty acids | |
CA Prop 65 Developmental Toxin U.S. TRI Developmental Toxin CA Prop 65 Female Reproductive Toxin CA Prop 65 Male Reproductive Toxin U.S. TRI Reproductive Toxin |
Not Listed Not Listed Not Listed Not Listed Not Listed |
|
Chemicals of Special Concern |
Alkyl-1,3-propylene diamine acetate, alkyl derived from coconut oil fatty acids | |
PAN
Bad Actors PAN Dirty Dozen list |
Not Listed Not Listed |
|
Water Pollution Potential and Criteria for Alkyl-1,3-propylene diamine acetate, alkyl derived from coconut oil fatty acids |
Water Pollution Potential |
||||
PAN Ground Water Contaminant Rating | Insufficient Data | |||
Sorry, no water quality standards or criteria have been established for this chemical by the U.S. or Canadian governments; however, there may be criteria established for related chemicals. |
||||
Regulatory Information for Alkyl-1,3-propylene diamine acetate, alkyl derived from coconut oil fatty acids |
International Regulatory Status |
|
|
UNEP Persistent Organic Pollutant (POP) UNEP Prior Informed Consent Chemical (PIC) WHO Obsolete Pesticide |
Not Listed Not Listed Not Listed |
|
U.S. and California Regulatory Status |
||
U.S. EPA Registered U.S. EPA Hazardous Air Pollutant U.S. EPA Minimum Risk Pesticide (25b list) CA Registered CA Groundwater Contaminant CA Toxic Air Contaminant |
Yes Not Listed No Yes Not Listed Not Listed |
|
Maximum Tolerance and Residue Levels |
||
Codex Alimentarius (UN FAO Maximum Residue Limits) U.S. Maximum Tolerance Levels European Union Maximum Residue Levels |
Go
to web site Go to web site Go to web site |
|
Ecotoxicity for Alkyl-1,3-propylene diamine acetate, alkyl derived from coconut oil fatty acids |
|
Aquatic Ecotoxicity |
All Toxic Effects for Organism Group |
|
Organism Group | Effects Noted |
---|---|
No effects noted for this chemical. Try related chemicals. |
|
Summary of Acute Toxicity for Organism Group |
||
Sorry, no acute aquatic ecotoxicity data available for this chemical. Try related chemicals. |
||
Terrestrial Ecotoxicity |
Summary of Acute Toxicity for Organism Group |
||
Sorry, no honeybee acute toxicity data available for this chemical. Try related chemicals. | ||
Note: Population-level effects on honeybees may occur even if a pesticide has low acute toxicity. For example, certain pesticides interfere with honeybee reproduction, ability to navigate, or temperature regulation, any of which can have an effect on long-term survival of honeybee colonies. The neonicotinoids, pyrethroids and keto-enol pesticides are some types of pesticides causing one or more of these effects. |
Honeybee Chronic Toxicity |
||
Organism Group | Chronic Toxicity | |
---|---|---|
Honeybees |
Related Chemicals for Alkyl-1,3-propylene diamine acetate, alkyl derived from coconut oil fatty acids |
CAS Number | Relation | Reason | Chemical Name | Chem Detail | Symptoms | California Use | Chem Use Type | U.S. EPA Reg | PAN Bad Actor |
---|---|---|---|---|---|---|---|---|---|
61790-63-7 | Parent | P | Alkyl-1,3-propylene diamine acetate, alkyl derived from coconut oil fatty acids | ![]() |
![]() |
![]() |
Microbiocide, Soap or Surfactant | Yes | Not Listed |
68526-65-8 | Related | 2 | Alkyl*-diamine monobenzoate *(as in fatty acids of coconut oil) | ![]() |
![]() |
![]() |
Microbiocide, Adjuvant | No | Not Listed |
Related | 2 | Alkyl-1,3-propylene diamine, alkyl derived from coconut oil fatty acids | ![]() |
![]() |
![]() |
Microbiocide, Soap or Surfactant | No | Not Listed | |
Related | 2 | Mixed fatty alkyl* diamines *(42%C12, 26%C18, 15%C14, 8%C16, 5%C10, 4%C8) | ![]() |
![]() |
![]() |
Microbiocide | No | Not Listed | |
68188-29-4 | Related | 2 | N-Alkyl-1,3-propylene diamine monobenzoate, alkyl derived from coconut oil fatty acids | ![]() |
![]() |
![]() |
Microbiocide, Soap or Surfactant | No | Not Listed |
68856-30-4 | Related | 2 | N-cis-9-Octadecenyl-1,3-propylenediamine diacetate | ![]() |
![]() |
![]() |
Microbiocide | No | Not Listed |
Working with the Information on this Page | |
Click on underlined terms for definitions or go to the Pesticide Tutorial overview page. Any underlined term with a book icon * Data marked with an asterisk indicates that this chemical is not explicitly listed on the corresponding list. Instead, it belongs to a group of chemicals that IS designated on the list. For example, if an agency assigns a classification of reproductive toxicant
to "mercury compounds", that classification is applied to all mercury compounds in the PAN Pesticide database, which are then marked with an asterisk. |